]> git.mjollnir.org Git - moodle.git/shortlog
moodle.git
2009-10-01 skodakMDL-12886 WS param and return description classes
2009-10-01 stronk7NOBUG: Just adding some "database" words here and there...
2009-10-01 mudrd8mzremoving deletions from {blog_association} from the...
2009-10-01 mudrd8mzNOBUG: Fixed moodle_url issue in module removing confir...
2009-10-01 tjhuntquestion import/export: MDL-20299 fix regression I...
2009-10-01 tjhuntquestion preview: MDL-19820 set_url and generaltype...
2009-10-01 tjhuntquiz: fix debugging notice ->classes = to set_classes.
2009-10-01 skodakMDL-20385 better access control checks for frontpage...
2009-10-01 moodlercalendar MDL-19940 Don't require login for site calenda...
2009-10-01 moodlerform/recaptcha MDL-20144 Don't specify tabindex, for...
2009-10-01 dongsheng"MDL-16597, fixed callback function"
2009-10-01 samhemelrykjavascript MDL-20400 Addition of disabledif hide option...
2009-10-01 samhemelryknavigation MDL-20395 Fixed notificiation regarding...
2009-10-01 samhemelryknavigation MDL-20395 Fixed regression created earlier
2009-10-01 jeromeuser MDL-20390 remove broken unit test for user externa...
2009-10-01 samhemelrykadmin-roles MDL-19787 Fixed regression in recent upgrad...
2009-10-01 samhemelryksimpletest-navigation MDL-20395 Fixed up regressions...
2009-10-01 moodlerobotUpdated the HEAD build version to 20091001
2009-10-01 ashleyholmanMDL-5223 fix flashvars in mediafilter to make waitForPl...
2009-10-01 moodlerobotAutomatic installer.php lang files by installer_builder...
2009-09-30 tjhuntunittests: NOBUG fix pagelib unit tests
2009-09-30 tjhuntunit tests: MDL-20398 spurious exceptions when $CFG...
2009-09-30 tjhuntunit tests: MDL-20398 spurious exceptions when $CFG...
2009-09-30 tjhuntquestion import/export: MDL-20299 fatal error cause...
2009-09-30 tjhuntunittests: NOBUG further fix to HTML expectations ...
2009-09-30 tjhuntunittests: NOBUG fix outputlib unit tests
2009-09-30 tjhuntunittests: NOBUG further fix to HTML expectations.
2009-09-30 tjhuntunittests: NOBUG further pagelib unit test fixes
2009-09-30 tjhuntunittests: NOBUG fix pagelib unit tests
2009-09-30 tjhuntunittests: NOBUG improve testrss.php failure message...
2009-09-30 tjhuntunittests: NOBUG fix expectations for content with...
2009-09-30 tjhuntunit tests: MDL-20393 temporary work-around for this...
2009-09-30 tjhuntunit tests: MDL-20391 temporary work-around for this...
2009-09-30 tjhuntunit tests: MDL-20390 temporary work-around for this...
2009-09-30 tjhuntunit tests: MDL-20391 temporary work-around for this...
2009-09-30 tjhuntquestion types: MDL-20157 export_to_xml and import_from...
2009-09-30 tjhuntquiz: MDL-19145 Safe Exam Browser integration.
2009-09-30 samhemelrykgrade MDL-19797 Upgraded deprecated function calls
2009-09-30 samhemelrykfilter MDL-19796 Upgraded deprecated function calls
2009-09-30 samhemelrykenrol MDL-19795 Upgraded call to print_header_with_help
2009-09-30 samhemelrykblocks MDL-19791 Upgrade deprecated function calls
2009-09-30 samhemelrykauth MDL-19788 Upgrade deprecated function calls
2009-09-30 samhemelrykadmin MDL-19787 Upgrade deprecated function calls
2009-09-30 samhemelrykcore MDL-19799 Upgraded deprecated calls and minor...
2009-09-30 samhemelrykmessage MDL-19801 Fixed regression from recent update...
2009-09-30 moodlerobotUpdated the HEAD build version to 20090930
2009-09-29 samhemelrykmessage MDL-19801 Fixed regression from recent update
2009-09-29 skodakMDL-20371 improved warning string
2009-09-29 ashleyholmanMDL-20374 default exception handler: log backtrace...
2009-09-29 samhemelrykmessage MDL-19801 Regression caused by recent upgrades
2009-09-29 samhemelrykmessage MDL-19801 Added missing OUTPUT global
2009-09-29 jeromeoutput MDL-19788 fix missing global $OUTPUT
2009-09-29 pichetpmod-quiz MDL-19813 $OUPUT and cm defined correctly
2009-09-29 samhemelryklogin MDL-19800 Upgrade deprecated calls and added...
2009-09-29 samhemelrykmessage MDL-19801 Upgrade deprecated calls and added...
2009-09-29 samhemelryknotes MDL-19818 Upgrade deprecated calls and added...
2009-09-29 samhemelrykcalendar MDL-19793 Upgrade deprecated calls and added...
2009-09-29 moodlerobotUpdated the HEAD build version to 20090929
2009-09-28 stronk7MDL-17491 oci native driver: fix LOB meta length and...
2009-09-28 stronk7MDL-17491 oci native driver: alter column from TEXT...
2009-09-28 stronk7MDL-14679 table/column meta cache is reset on each...
2009-09-28 ethemFatal error: Call to a member function checkbox() on...
2009-09-28 skodakMDL-20371 backups should never be in site files, let...
2009-09-28 stronk7MDL-14679: mssql and oracle generators now supporting...
2009-09-28 stronk7MDL-17491 oci native driver: adding support for local...
2009-09-28 stronk7MDL-14679 temporary tables: modify approach so name...
2009-09-28 skodakMDL-20369 fixed restoring of default sort
2009-09-28 skodakMDL-20369 fixed incorrect fetching of data fields ...
2009-09-28 stronk7MDL-17491 oci native driver: prevent get_columns()...
2009-09-28 mudrd8mzMDL-19542 Outcomes report display the name of the activ...
2009-09-28 moodlerobotUpdated the HEAD build version to 20090928
2009-09-28 moodlerobotAutomatic installer.php lang files by installer_builder...
2009-09-27 skodakMDL-11896 added hint if entry awaits approval
2009-09-27 skodakMDL-20209 fixed regression - the email has to be synced...
2009-09-27 mudrd8mzMDL-20336 Apply course defaults when approving the...
2009-09-27 moodlerobotUpdated the HEAD build version to 20090927
2009-09-26 skodakMDL-19269 Deleted internal auth users - handling is...
2009-09-26 skodakMDL-20209 fixed incorrect mail sync with ext auths
2009-09-26 skodakMDL-20355 teachers may not see overview of all students...
2009-09-26 skodakMDL-20311 refactoring regression - thanks Clyde Tan...
2009-09-26 arborrowMDL-20353 - fixing typo
2009-09-26 skodakMDL-20353 adding missing data types of hidden form...
2009-09-26 moodlerobotUpdated the HEAD build version to 20090926
2009-09-25 stronk7MDL-17491 oracle driver: specify cache size always...
2009-09-25 stronk7MDL-17491 oracle native driver: when renaming tables...
2009-09-25 samhemelrykrequires-css MDL-16151 Support for css files that use...
2009-09-25 pichetpquestion MDL-19820 Adding global $OUTPUT
2009-09-25 gbatesonstricter checking of null fields when restoring HotPots...
2009-09-25 samhemelrykcore MDL-19791 Replaced deprecated functions, added...
2009-09-25 samhemelrykcourse MDL-19794 Replaced deprecated functions, added...
2009-09-25 samhemelrykquestion MDL-19820 Replaced deprecated functions
2009-09-25 samhemelrykuser MDL-19825 Added set_url calls, replaced deprecated...
2009-09-25 pichetpMDL-10110 Adding validation for multichoice option...
2009-09-25 pichetpMDL-10110 Adding multichoice option in calculated quest...
2009-09-25 moodlerobotUpdated the HEAD build version to 20090925
2009-09-24 stronk7MDL-19057 fix default test, rename one reserved word...
2009-09-24 stronk7MDL-17491 oracle native driver: disable sequence cache...
2009-09-24 stronk7MDL-17491 oracle native driver: add missing tables...
2009-09-24 stronk7Better handling of FLOATS in oracle generator
2009-09-24 pichetpMDL-10110 Adding multichoice option in calculated question
next