projects / moodle.git / shortlog
? search:
summary | shortlog | log | commit | commitdiff | tree
first ⋅ prev ⋅ next
moodle.git
2009-10-01 mudrd8mzremoving deletions from {blog_association} from the... commit | commitdiff | tree | snapshot
2009-10-01 mudrd8mzNOBUG: Fixed moodle_url issue in module removing confir... commit | commitdiff | tree | snapshot
2009-10-01 tjhuntquestion import/export: MDL-20299 fix regression I... commit | commitdiff | tree | snapshot
2009-10-01 tjhuntquestion preview: MDL-19820 set_url and generaltype... commit | commitdiff | tree | snapshot
2009-10-01 tjhuntquiz: fix debugging notice ->classes = to set_classes. commit | commitdiff | tree | snapshot
2009-10-01 skodakMDL-20385 better access control checks for frontpage... commit | commitdiff | tree | snapshot
2009-10-01 moodlercalendar MDL-19940 Don't require login for site calenda... commit | commitdiff | tree | snapshot
2009-10-01 moodlerform/recaptcha MDL-20144 Don't specify tabindex, for... commit | commitdiff | tree | snapshot
2009-10-01 dongsheng"MDL-16597, fixed callback function" commit | commitdiff | tree | snapshot
2009-10-01 samhemelrykjavascript MDL-20400 Addition of disabledif hide option... commit | commitdiff | tree | snapshot
2009-10-01 samhemelryknavigation MDL-20395 Fixed notificiation regarding... commit | commitdiff | tree | snapshot
2009-10-01 samhemelryknavigation MDL-20395 Fixed regression created earlier commit | commitdiff | tree | snapshot
2009-10-01 jeromeuser MDL-20390 remove broken unit test for user externa... commit | commitdiff | tree | snapshot
2009-10-01 samhemelrykadmin-roles MDL-19787 Fixed regression in recent upgrad... commit | commitdiff | tree | snapshot
2009-10-01 samhemelryksimpletest-navigation MDL-20395 Fixed up regressions... commit | commitdiff | tree | snapshot
2009-10-01 moodlerobotUpdated the HEAD build version to 20091001 commit | commitdiff | tree | snapshot
2009-10-01 ashleyholmanMDL-5223 fix flashvars in mediafilter to make waitForPl... commit | commitdiff | tree | snapshot
2009-10-01 moodlerobotAutomatic installer.php lang files by installer_builder... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG fix pagelib unit tests commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20398 spurious exceptions when $CFG... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20398 spurious exceptions when $CFG... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntquestion import/export: MDL-20299 fatal error cause... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG further fix to HTML expectations ... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG fix outputlib unit tests commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG further fix to HTML expectations. commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG further pagelib unit test fixes commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG fix pagelib unit tests commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG improve testrss.php failure message... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunittests: NOBUG fix expectations for content with... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20393 temporary work-around for this... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20391 temporary work-around for this... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20390 temporary work-around for this... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntunit tests: MDL-20391 temporary work-around for this... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntquestion types: MDL-20157 export_to_xml and import_from... commit | commitdiff | tree | snapshot
2009-09-30 tjhuntquiz: MDL-19145 Safe Exam Browser integration. commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykgrade MDL-19797 Upgraded deprecated function calls commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykfilter MDL-19796 Upgraded deprecated function calls commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykenrol MDL-19795 Upgraded call to print_header_with_help commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykblocks MDL-19791 Upgrade deprecated function calls commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykauth MDL-19788 Upgrade deprecated function calls commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykadmin MDL-19787 Upgrade deprecated function calls commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykcore MDL-19799 Upgraded deprecated calls and minor... commit | commitdiff | tree | snapshot
2009-09-30 samhemelrykmessage MDL-19801 Fixed regression from recent update... commit | commitdiff | tree | snapshot
2009-09-30 moodlerobotUpdated the HEAD build version to 20090930 commit | commitdiff | tree | snapshot
2009-09-29 samhemelrykmessage MDL-19801 Fixed regression from recent update commit | commitdiff | tree | snapshot
2009-09-29 skodakMDL-20371 improved warning string commit | commitdiff | tree | snapshot
2009-09-29 ashleyholmanMDL-20374 default exception handler: log backtrace... commit | commitdiff | tree | snapshot
2009-09-29 samhemelrykmessage MDL-19801 Regression caused by recent upgrades commit | commitdiff | tree | snapshot
2009-09-29 samhemelrykmessage MDL-19801 Added missing OUTPUT global commit | commitdiff | tree | snapshot
2009-09-29 jeromeoutput MDL-19788 fix missing global $OUTPUT commit | commitdiff | tree | snapshot
2009-09-29 pichetpmod-quiz MDL-19813 $OUPUT and cm defined correctly commit | commitdiff | tree | snapshot
2009-09-29 samhemelryklogin MDL-19800 Upgrade deprecated calls and added... commit | commitdiff | tree | snapshot
2009-09-29 samhemelrykmessage MDL-19801 Upgrade deprecated calls and added... commit | commitdiff | tree | snapshot
2009-09-29 samhemelryknotes MDL-19818 Upgrade deprecated calls and added... commit | commitdiff | tree | snapshot
2009-09-29 samhemelrykcalendar MDL-19793 Upgrade deprecated calls and added... commit | commitdiff | tree | snapshot
2009-09-29 moodlerobotUpdated the HEAD build version to 20090929 commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-17491 oci native driver: fix LOB meta length and... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-17491 oci native driver: alter column from TEXT... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-14679 table/column meta cache is reset on each... commit | commitdiff | tree | snapshot
2009-09-28 ethemFatal error: Call to a member function checkbox() on... commit | commitdiff | tree | snapshot
2009-09-28 skodakMDL-20371 backups should never be in site files, let... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-14679: mssql and oracle generators now supporting... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-17491 oci native driver: adding support for local... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-14679 temporary tables: modify approach so name... commit | commitdiff | tree | snapshot
2009-09-28 skodakMDL-20369 fixed restoring of default sort commit | commitdiff | tree | snapshot
2009-09-28 skodakMDL-20369 fixed incorrect fetching of data fields ... commit | commitdiff | tree | snapshot
2009-09-28 stronk7MDL-17491 oci native driver: prevent get_columns()... commit | commitdiff | tree | snapshot
2009-09-28 mudrd8mzMDL-19542 Outcomes report display the name of the activ... commit | commitdiff | tree | snapshot
2009-09-28 moodlerobotUpdated the HEAD build version to 20090928 commit | commitdiff | tree | snapshot
2009-09-28 moodlerobotAutomatic installer.php lang files by installer_builder... commit | commitdiff | tree | snapshot
2009-09-27 skodakMDL-11896 added hint if entry awaits approval commit | commitdiff | tree | snapshot
2009-09-27 skodakMDL-20209 fixed regression - the email has to be synced... commit | commitdiff | tree | snapshot
2009-09-27 mudrd8mzMDL-20336 Apply course defaults when approving the... commit | commitdiff | tree | snapshot
2009-09-27 moodlerobotUpdated the HEAD build version to 20090927 commit | commitdiff | tree | snapshot
2009-09-26 skodakMDL-19269 Deleted internal auth users - handling is... commit | commitdiff | tree | snapshot
2009-09-26 skodakMDL-20209 fixed incorrect mail sync with ext auths commit | commitdiff | tree | snapshot
2009-09-26 skodakMDL-20355 teachers may not see overview of all students... commit | commitdiff | tree | snapshot
2009-09-26 skodakMDL-20311 refactoring regression - thanks Clyde Tan... commit | commitdiff | tree | snapshot
2009-09-26 arborrowMDL-20353 - fixing typo commit | commitdiff | tree | snapshot
2009-09-26 skodakMDL-20353 adding missing data types of hidden form... commit | commitdiff | tree | snapshot
2009-09-26 moodlerobotUpdated the HEAD build version to 20090926 commit | commitdiff | tree | snapshot
2009-09-25 stronk7MDL-17491 oracle driver: specify cache size always... commit | commitdiff | tree | snapshot
2009-09-25 stronk7MDL-17491 oracle native driver: when renaming tables... commit | commitdiff | tree | snapshot
2009-09-25 samhemelrykrequires-css MDL-16151 Support for css files that use... commit | commitdiff | tree | snapshot
2009-09-25 pichetpquestion MDL-19820 Adding global $OUTPUT commit | commitdiff | tree | snapshot
2009-09-25 gbatesonstricter checking of null fields when restoring HotPots... commit | commitdiff | tree | snapshot
2009-09-25 samhemelrykcore MDL-19791 Replaced deprecated functions, added... commit | commitdiff | tree | snapshot
2009-09-25 samhemelrykcourse MDL-19794 Replaced deprecated functions, added... commit | commitdiff | tree | snapshot
2009-09-25 samhemelrykquestion MDL-19820 Replaced deprecated functions commit | commitdiff | tree | snapshot
2009-09-25 samhemelrykuser MDL-19825 Added set_url calls, replaced deprecated... commit | commitdiff | tree | snapshot
2009-09-25 pichetpMDL-10110 Adding validation for multichoice option... commit | commitdiff | tree | snapshot
2009-09-25 pichetpMDL-10110 Adding multichoice option in calculated quest... commit | commitdiff | tree | snapshot
2009-09-25 moodlerobotUpdated the HEAD build version to 20090925 commit | commitdiff | tree | snapshot
2009-09-24 stronk7MDL-19057 fix default test, rename one reserved word... commit | commitdiff | tree | snapshot
2009-09-24 stronk7MDL-17491 oracle native driver: disable sequence cache... commit | commitdiff | tree | snapshot
2009-09-24 stronk7MDL-17491 oracle native driver: add missing tables... commit | commitdiff | tree | snapshot
2009-09-24 stronk7Better handling of FLOATS in oracle generator commit | commitdiff | tree | snapshot
2009-09-24 pichetpMDL-10110 Adding multichoice option in calculated question commit | commitdiff | tree | snapshot
2009-09-24 stronk7MDL-19057 No more exceptions in tests for oracle. If... commit | commitdiff | tree | snapshot
2009-09-24 stronk7NOBUG. Quick fix to provide cross-db comparison of... commit | commitdiff | tree | snapshot
next
Unnamed repository; edit this file to name it for gitweb.